PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010942594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 299aa    MW: 34304.6 Da    PI: 6.7666
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010942594.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.9e-51261523128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPtdeelv +yL++kve+k+l++ e+ik++diyk++PwdLpk++ ++ekewyfF+ r +ky+++ r+nr+t sg+Wkatg d++v+s+  
  XP_010942594.1  26 PGFRFHPTDEELVGFYLRRKVEKKPLTI-EIIKQIDIYKYDPWDLPKSTVGGEKEWYFFCLRGRKYRNSIRPNRVTGSGFWKATGIDRPVYSAgd 119
                     9***************************.89***************8777899***************************************866 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      g  +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  XP_010942594.1 120 AGDCIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 152
                     6677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5523179IPR003441NAC domain
PROSITE profilePS5100554.18324179IPR003441NAC domain
PfamPF023653.4E-2526152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MEEKMDKKCA GVEQEVVLEE EDVPLPGFRF HPTDEELVGF YLRRKVEKKP LTIEIIKQID  60
IYKYDPWDLP KSTVGGEKEW YFFCLRGRKY RNSIRPNRVT GSGFWKATGI DRPVYSAGDA  120
GDCIGLKKSL VYYRGSAGKG TKTDWMMHEF RLPASAKNND ISPSIQEAEI WTICRIFKRN  180
ISSRKYPQDL KSSTSKQMPT DSSSKTSSFE SDTGDEYKCF GSSNIPQGEM KSITSYYEEK  240
NQSLASQWNS VPQAPLTTLY PNIPNTSTNE FFRDNNWDEL GRIMEFMVDP SAGHECRYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51111855171NO APICAL MERISTEM PROTEIN
1ut4_B2e-51111855171NO APICAL MERISTEM PROTEIN
1ut7_A2e-51111855171NO APICAL MERISTEM PROTEIN
1ut7_B2e-51111855171NO APICAL MERISTEM PROTEIN
3swm_A2e-51111858174NAC domain-containing protein 19
3swm_B2e-51111858174NAC domain-containing protein 19
3swm_C2e-51111858174NAC domain-containing protein 19
3swm_D2e-51111858174NAC domain-containing protein 19
3swp_A2e-51111858174NAC domain-containing protein 19
3swp_B2e-51111858174NAC domain-containing protein 19
3swp_C2e-51111858174NAC domain-containing protein 19
3swp_D2e-51111858174NAC domain-containing protein 19
4dul_A2e-51111855171NAC domain-containing protein 19
4dul_B2e-51111855171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942594.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK557e-93NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM0SUZ61e-128M0SUZ6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P02170_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-88NAC domain containing protein 42